SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000012539 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000012539
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.61e-30
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000012539   Gene: ENSOANG00000007876   Transcript: ENSOANT00000012541
Sequence length 101
Comment pep:known_by_projection supercontig:OANA5:Contig29714:4933:7655:1 gene:ENSOANG00000007876 transcript:ENSOANT00000012541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLVLTKIEHLCSGAAYCQFMDMLFPGSVALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVXXXXXXXXXXXXXX
Download sequence
Identical sequences F7E7X3
ENSOANP00000012539 ENSOANP00000012539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]