SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000014218 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000014218
Domain Number 1 Region: 623-922
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-84
Family Protein kinases, catalytic subunit 0.000000000697
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-73
Family Ephrin receptor ligand binding domain 0.000000969
Further Details:      
 
Domain Number 3 Region: 328-534
Classification Level Classification E-value
Superfamily Fibronectin type III 7.58e-43
Family Fibronectin type III 0.0000795
Further Details:      
 
Domain Number 4 Region: 917-992
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000014218
Domain Number - Region: 266-305
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00106
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000014218   Gene: ENSOANG00000008930   Transcript: ENSOANT00000014221
Sequence length 995
Comment pep:known_by_projection ultracontig:OANA5:Ultra542:3857346:4030679:1 gene:ENSOANG00000008930 transcript:ENSOANT00000014221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVRPSWIIACYLWLLRLARPGEAQAAREVILLDSKSQQTELEWISSPSNGWEEISGLDE
NYTPIRTYQVCQVMEPNQNNWLRTSWIAKGNAQRIFVELKFTLRDCNSLPGVLGTCKETF
NLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFY
LAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVHSAEEEAE
NSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPSHSFSD
KEGSSRCDCEDGYYRALADPPYVACTRPPSAPQNLIFNINQTTVSLEWNPPADNGGRNDV
TYRVLCKRCSWEQGECVPCGSNVGYLPQQSGLADNFVTVTDLLAHANYTFEVEAVNGVSD
LSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEK
DQRERTYSTVKTKSTSVSINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMF
EATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFP
GTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVA
IKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEYMENGALDAFL
RKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVI
EDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQ
DVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKDRGERPKFEQIVGILDKMIRNPNSLKTP
LGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDV
MSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences F7D2V3
ENSOANP00000014218 ENSOANP00000014218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]