SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000015543 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000015543
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-21
Family Ubiquitin-related 0.0000221
Further Details:      
 
Domain Number 2 Region: 225-290
Classification Level Classification E-value
Superfamily XPC-binding domain 1.1e-20
Family XPC-binding domain 0.0000449
Further Details:      
 
Domain Number 3 Region: 300-358
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000179
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 147-201
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000148
Family UBA domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000015543   Gene: ENSOANG00000009800   Transcript: ENSOANT00000015546
Sequence length 360
Comment pep:known_by_projection ultracontig:OANA5:Ultra710:3266:9622:-1 gene:ENSOANG00000009800 transcript:ENSOANT00000015546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTITLKTLQQQTFKIRMEPEETVKVLKEKIEAEKGQDAFPVAGQKLIYAGKILNDDTP
IRDYKIDEKNFVVVMVTKTKSGLGTSVPPETAPASEPSVSAPAASIVAMPLTPSSPKEER
PTADNPTSLPPPETVTGSVPSSGSIGREDDAASTLVTGSEYETMLTEIMSMGYEQEQVVA
ALRASFNNPHRAVEYLLMGIPGSPEPEGGPIQESQSNEQAAVEGGENPLEFLRDQPQFQN
MRQVIQQNPALLPALLQQLGQENPHLLQQISLHQEQFIQMLNEPSGELGDMSDIEGEIGA
IGDEPTQMSYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Download sequence
Identical sequences F6STA7
XP_001513724.1.37387 ENSOANP00000015543 ENSOANP00000015543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]