SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000018643 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000018643
Domain Number 1 Region: 438-537
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.9e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000218
Further Details:      
 
Domain Number 2 Region: 647-723
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000132
Further Details:      
 
Domain Number 3 Region: 580-653
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 4 Region: 1046-1122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000125
Further Details:      
 
Domain Number 5 Region: 729-832
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.67e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 6 Region: 970-1048
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000118
Further Details:      
 
Domain Number 7 Region: 146-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.24e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000115
Further Details:      
 
Domain Number 8 Region: 1118-1195
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000639
Further Details:      
 
Domain Number 9 Region: 346-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.13e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000509
Further Details:      
 
Domain Number 10 Region: 867-919,946-969
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 11 Region: 291-367
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 12 Region: 219-293
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000018643
Domain Number - Region: 100-149
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0349
Family Eukaryotic type KH-domain (KH-domain type I) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000018643   Gene: ENSOANG00000011759   Transcript: ENSOANT00000018646
Sequence length 1266
Comment pep:novel chromosome:OANA5:7:31283338:31328438:1 gene:ENSOANG00000011759 transcript:ENSOANT00000018646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFAEHRSGLAQQQPILVAALNSEDDSDPPTYKDAFPPLPEKAACLEASQE
PAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSL
AKDQGLSIMVSGKLEAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELK
TATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLDVEKVFHPFIAG
PYNKLVGEIMQETGTRINIPPASVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIA
VEVKKSQHKYVVGPKGNSLQEILERTGVSVEIPPTDSSSETVILRGEPEKLGQALTEVYA
KANSFMVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVTV
AQEQIEIMVKDLIIRMDYVEINIDHKFHRHLIGKNGANINRIKDQYKVSVRIPPDNEKSN
LIRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIRDKFPE
VIINFPDPAHKSDVVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGK
GGANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANISEVEVS
IPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPTEGSGSDTVTIRGPAQDVEKAKKQLLHL
AEEKQTKSYTVDLRAKPEYHKFLIGKGGGNIRKVRDNTGARIIFPTSEDKDQELITIMGT
EEAVKEAQKELEALIKNLDNVVEDFMLVDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPR
SGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTMECTIPQKFHRSIMGPKGSRIQQI
TRDFGVQIKFPDREETPAPNAEPAVQENGEESAEGKEADPSSPKKCDIIIISGRKEKCEA
AKEALEALVPVTIEVEVSFDLHRYIIGQKGSGIRKMMDEFEVNIQVPAPELQSDIITITG
LAANLDRAKAGLLERVKELQAEQEDRVLRSFKLNVTVDPKYHPKIIGRKGAVITQIRMEH
EVNIQFPDKDDENQSQDQITITGYEKNTEAARDAIMKIVGELEQMVSEDVPLDHRVHARI
IGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVV
DNEAIQVYMKPSTHEESKAPSKGFVVRDAPWTASNNEKAPDMSSSEDFPSFGAQVAPKTL
PWGPKR
Download sequence
Identical sequences F6T0U5
ENSOANP00000018643 ENSOANP00000018643 9258.ENSOANP00000018643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]