SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000019813 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000019813
Domain Number 1 Region: 96-209
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-22
Family Nuclear receptor ligand-binding domain 0.00000548
Further Details:      
 
Domain Number 2 Region: 32-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000056
Family Nuclear receptor 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000019813   Gene: ENSOANG00000012527   Transcript: ENSOANT00000019816
Sequence length 209
Comment pep:known_by_projection supercontig:OANA5:Contig67141:953:4294:1 gene:ENSOANG00000012527 transcript:ENSOANT00000019816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPAPPTAIETQSTSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKRLG
KHVLSLQEKFYQCHLGAEQRNKWGERIMDYGPTPPAVRNDRNKKKKEPSKAECSESCSLT
PEVEELIGKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDVDLWDKFSELSTKCIIKTVE
FAKQLPGFTTLTIADQITLLKAACLDILV
Download sequence
Identical sequences F7E1E6
ENSOANP00000019813 9258.ENSOANP00000019813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]