SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000031268 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000031268
Domain Number 1 Region: 67-183
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-29
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 7-57
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000994
Family Calponin-homology domain, CH-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000031268   Gene: ENSOANG00000030155   Transcript: ENSOANT00000040513
Sequence length 187
Comment pep:novel supercontig:OANA5:Contig12079:10972:15286:1 gene:ENSOANG00000030155 transcript:ENSOANT00000040513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTVAVQSNLANLEHAFYVAEKIGVTRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPE
GGEGINANDVEVKWVEYQNMVNYLIQWIRHHVTIISDRTFPNNPIELKALYNQYLQFKET
EIPPKEIEKSKIKRLYKLLEVWIEFGRIKLLQGYHPNDIEKEWGKLIIAMLEREKLLRPE
VERYVCM
Download sequence
Identical sequences K7ECL1
ENSOANP00000031268 ENSOANP00000031268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]