SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000032055 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000032055
Domain Number 1 Region: 40-115
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.7e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 2 Region: 5-26
Classification Level Classification E-value
Superfamily EF-hand 0.0000406
Family Polcalcin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000032055   Gene: ENSOANG00000032079   Transcript: ENSOANT00000041304
Sequence length 140
Comment pep:novel supercontig:OANA5:Contig27244:9810:12752:-1 gene:ENSOANG00000032079 transcript:ENSOANT00000041304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVASIFDTNGDGFIDYCEFVSALHPSRDPRGRGPDADRIQDEVTRQVSQCNCARRFLV
EQISANRYRFGESQQLRMVRILRSSLMVRVGGGWIALDEFLVKNDPCRGEGRSNDQPVDD
IDREQGAVLSGWERTVQQSW
Download sequence
Identical sequences K7EEU8
ENSOANP00000032055 ENSOANP00000032055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]