SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028009|Sb01g002360 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5028009|Sb01g002360
Domain Number - Region: 48-97
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0712
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028009|Sb01g002360
Sequence length 168
Sequence
MYPDAAPYEAAPGGVVVAPVAGLFPGAGASREWSSGLFDCFDDFDTCCLTFWCPCITFGR
TAEIVDHGTTSCGTSGALFALIEYLSGTWCTWAYSCTYRGRMRAQHGLPEAPCADFLVHL
CCLPCALCQEYRELKARGYEPVLGWEFNAQRAAAGVAMSAPAVQGMGR
Download sequence
Identical sequences C5WU02
XP_002463577.1.57931 4558.Sb01g002360.1 jgi|Sorbi1|5028009|Sb01g002360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]