SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028190|Sb01g005710 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5028190|Sb01g005710
Domain Number 1 Region: 66-105,307-543
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.29e-70
Family FolH catalytic domain-like 0.000032
Further Details:      
 
Domain Number 2 Region: 112-325
Classification Level Classification E-value
Superfamily PA domain 1.83e-46
Family PA domain 0.0000541
Further Details:      
 
Domain Number 3 Region: 544-696
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 3.92e-30
Family Transferrin receptor-like dimerisation domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028190|Sb01g005710
Sequence length 711
Sequence
MPHSVLARLPHGSIRLVVAFGLLLLVSLLVLHRRPGRPHAAAAAAGGRLSDPAGLFLSLS
PGANASIAADLRALTAGPHLAGTRASAGAAAHVLARLRAAGLRTLTREYEPLLSYPGHAS
LALLRPDGSLLARLSLEEPADVGRRVVRPYHAYAPSGGAVAEAVFVNLGREEDYAALERL
GVGVRGRVAVARRGGGYRGGVVARAAEKGAVAVLIAGNADGGVERGVVLLGGPGDPLTPG
WAATSGAERLGFDDKAVKRRFPSIPSMPVSAKTAAAIIRSLGGPAMPAEWKDGLGVDVGG
VGPGPTLVNFTYQEDRKFYKIRDIFGIIKGQEEPDRYVILGNHRDAWTYGAVDPNSGTAA
LLDIARRLGTMLQSGWKPRRSIILCSWDAEEFGMIGSTEWVEENLEDLHSKAVAYLNVDC
AVQGVGFFAGSTPQLDKLLVDITRQVKDPDVTGKMVHDTWNEMSGSIKIERLARTDSDFA
PFLHHAGIPSVDLYYGEEFPGYHTALDTYNWMEKHGDPLFLRHLAITEIWGLLALRLAND
PVLPFDYQAYTSDLQEHIKTFSALTDNGHAVNLMNGFVNDLSGAAMEVVKEMKKLQQLDL
YDDHARMRRRLLNDRLLLAERSFLQPEGLQGRGWFKHLLYSPPEDYESKFSFFPGIADAI
SRSANLSDKEREVAVQHEVWKVCRAIQRAASVLRGEFSERKPINFSSLVAP
Download sequence
Identical sequences C5WY45
4558.Sb01g005710.1 jgi|Sorbi1|5028190|Sb01g005710 XP_002466328.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]