SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028568|Sb01g013060 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5028568|Sb01g013060
Domain Number 1 Region: 390-700
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.93e-79
Family Protein kinases, catalytic subunit 0.0000439
Further Details:      
 
Domain Number 2 Region: 287-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5028568|Sb01g013060
Domain Number - Region: 244-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 109-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0775
Family Glycosyl hydrolase family 7 catalytic core 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028568|Sb01g013060
Sequence length 734
Sequence
MLLPAFLLQPLLLACFFSSFVHPMEPNTSRSWRCANMSIPYPFGIAGDGGSPFLSQGFQI
SCGSRRSAALSGPSLPIGNSVFGILDISLLDGFVTIAASASSQQCKGNSSFTLEGTIFTY
SDTRNKFTALGCNVVAMLLNGSSGGYTGGCASFCSTKDNIVNGSCSGVACCQAPVPKGLK
KMELEFSIISNKYNSTPPCGEAFIVEQNKYVFSSLDLDNKPQYRPVVLEWSIDGGSCEEA
KQSSTSYACRENTYCYNSPNGIGYRCNCSDGFQGNPYLPGPDGGCQDIDECTTRNPCTHK
CVNTKPGFHCRCPAGMSGDGFKEGSGCNGVGTLTIAGVTGLALLVLLFILGFWTHWLVKK
RKLAKTKQRYFMQNGGLLLKQQMFSERAPLHIFTSSELDKATSNFSDDNIIGRGGFGTVY
KGILSNQVVVAIKKAQRVDQTQMEQFVNELIILSQANHKHVVQLLGCCLETEVPLLVYEF
ITNGALFHHLHNTSSPMSWENRLSIAVETASALAYLHLATKMPIIHRDVKSSNILLDENF
TAKVSDFGASRPIPYNQTHVTTLVQGTLGYLDPEYFQTSQLTEKSDVYSFGVVLIELLTR
KKPIMDGMMEDVRSLVLQFSMLFHQNKLLEIVDPTVAEETGMRHIETIAKLALRCLRLKG
EERPRMIEVAIELEALRRLMKQHFIMKSESLLHESWCHEEMSIHAPSNFCLGDDDIPEDE
SQEIILLPSNSLSA
Download sequence
Identical sequences C5WR16
XP_002464142.1.57931 XP_021317645.1.57931 XP_021317651.1.57931 4558.Sb01g013060.1 jgi|Sorbi1|5028568|Sb01g013060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]