SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028614|Sb01g013860 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5028614|Sb01g013860
Domain Number 1 Region: 474-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-74
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 88-165,246-261
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-22
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028614|Sb01g013860
Sequence length 801
Sequence
MQHLHMSIIILLLLAFLFPLDAVAGLSAVAPPISWKVSNKADSKWITANGSFIDPVLDNS
IMSYTTYFGFYSIDGKSFILSIVISGPQAPVIWSANPENPVNSGAILNFTREGNLILHNG
DGTTVWSTATKSKSVAGMVLDVYGNLVLFDKDNISVWQSFDHPTDTLVLGQSLCRGMNLS
IRTSNTKWPSARVYFSAEWNGLQYSFKPAAFTKLFETSTIASTCCAFANGSFGFPDNIFF
LPSARSLQFMRLESDGHLRLYEMQGTLQDPLMLFDVLSTEMKFCDYPMACGDYGVCSKGQ
CSCPNLNDFRFQNERLPSAGCIPLRSPSCDHVQDNNNRLILLNNVLYFSNNTFLSFATST
SEDVCKQSCLIDCSCKVVLFRTNNNFSDSPSTNNNVSDSGYCLLLSEQMVILFAEDSSNH
FSAFLKIEGNRSDKRRISIVVGSIAGFCLISILVCAMVWKNCKKDKEPLFDGIPGIPKRF
SFDELKVATGHFSIKLGAGGFGSVFKGKIGKETIAVKRLEGVEQGMEEFLAEVKTIGRIH
HFNLVRLVGFCAEKSHRLLVYEYLSNGSLDKWIFHKSPVFTLSWKTRRHIILAIARGLSY
LHEECEEKIAHLDIKPQNILLDDRFNAKVSDFGLSKMINRDQSKVMTRMRGTRGYLAPEW
LGSKITEKADIYSFGIVMIEIICGRENLDESQPDESIHLISLLQEKARSGQLSDLVDSSS
NDMKFHLEEVVEAMKLAMWCLQVDSSRRPLLSTVAKVLEGVMSMETTPDCTFVPSFASNK
TNVEGSTSSYVTSESHLSGPR
Download sequence
Identical sequences 4558.Sb01g013860.1 jgi|Sorbi1|5028614|Sb01g013860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]