SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028636|Sb01g014196 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5028636|Sb01g014196
Domain Number 1 Region: 5-34
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000582
Family Eukaryotic type KH-domain (KH-domain type I) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028636|Sb01g014196
Sequence length 94
Sequence
ESRGAPGEMAVEIIGTAAQVQTAQQLIQNFMAEAAAPGPAPASNPPAPPVDPSYGSYPPP
YGAPPYGSSVAARPPLQYNGGSYGGPTYPPSYGY
Download sequence
Identical sequences 4558.Sb01g014196.1 jgi|Sorbi1|5028636|Sb01g014196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]