SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5028815|Sb01g016720 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5028815|Sb01g016720
Domain Number 1 Region: 546-833
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-82
Family Protein kinases, catalytic subunit 0.0000746
Further Details:      
 
Domain Number 2 Region: 88-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-23
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5028815|Sb01g016720
Domain Number - Region: 371-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Anti-platelet protein 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5028815|Sb01g016720
Sequence length 885
Sequence
MRRRRCPLLVAGVLLLVLLLLLVLLLPTAVRGTDTVTLDSPLKGNRTLVSAGRAKYVLGF
FAPDPDGTAGRTPTYLGIWFNGIPDRTVVWVANRESPVLGGVDAAELTVLANGSLAIVVD
DDQPPGAVVWATPPGTTSSGGGNATAYAQLLENGNLVLRVPGAGVVWQSFDYPTDTLLPG
MKLGIDFRTGLDRRMTSWRAAGDPSPGDYTFRLDPRGSPELFLSRRSARTYGSGPWNGYQ
FTGVPNLKSNSLLTFRFVSNADEAYYSYGVVDGASAAVTTRFVLNSSGQIQRLMWIDMTR
SWSVFWSYPLDECDGYRACGAYGVCSVERNPACGCVPGFDPRFPAEWALRDGSGGCRRRT
ELNCTGGDGFAMLTNMKLPESANATVDMSLGLDECRRTCLGNCACRAYASANVSSPGATG
CFMWTGDLLDMRQFGNGGQNLFVRLAASDLPVSSSSADTDARTKRLVEIIVPSVAAPLLL
LAGLYICAMKMKKRRKEKEAIPLALLRNAQRQGTPFGRRNQIAASTDVQDDSLHDGQQGS
SNQDCDLPSFDVETIKGATGNFSVHNKIGQGGFGPVYMGKLDNGQDIAVKRLSRRSTQGL
REFKNEVKLIAKLQHRNLVRLLGCCIDGSERMLVYEYMHNRSLNTFLFNEEKQSMLSWEK
RFNIINGIARGILYLHQDSALRIIHRDLKASNILLDKDMNPKISDFGVARIFGTDQTAAY
TKKVVGTYGYMSPEYAMDGVFSMKSDVFSFGVLVLEIVSGKKNRGFYHTELDLNLLRYAW
RLWKDGESLEFIDHSIAETSNAAEVLKCIQIGLLCVQEQPKRRPTMSAVTTMLTCESPTL
PEPCEPAFSTGRNHSDDDEEEEEPEVKACRSDSASSWTVTVVEGR
Download sequence
Identical sequences C5WV97
XP_002466921.1.57931 jgi|Sorbi1|5028815|Sb01g016720 4558.Sb01g016720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]