SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5029184|Sb01g022040 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5029184|Sb01g022040
Domain Number 1 Region: 129-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 2 Region: 47-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000829
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 3 Region: 473-547
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5029184|Sb01g022040
Sequence length 588
Sequence
MAQMQSSSKEKEVYEVTRKSNEQSVLKLDAVDDEDSGNTTSSAGESKYPGWPGTSVFRML
IPAQKVGVIIGHKGERVRRLCEETRACVRIIGGHLCAAEQAVIIFGREQPEEPLPPAMDA
LLRVYQQTINDESLDVGSDGVIVRRILVPSEQAESLIGEHGVMINSIMEASQTDIRVLDG
DLPPVALEEDRVVEIWGLPARVHKALELVASHLRKYLVDRSVIPLFDRHVPMPILHVDVP
PCHYIDYPEGPVHPVSPGYHSVSAEDLQHEQWIDTGYLRGRHPMGNLRHADTFEYRWEAH
TPFRRYRSVTPPNHAITPYGPEASSPMEAYLSAPMELHSHHNLQNRWHASPVNSTDSVER
IRSLISVYGQQARLQKQTCQSAKLGKHPQFGVSLHGREAHPTRVSPSDSTEQPPSPGVSA
CGREASPCFRMHPPTTVENLLHCRVSACGPETPLPLHLAATSSTSRSTAASQVKKKMQVP
IFYAEAVIGPAGERIEYIRRTSRSNILISNSDGAMSIEITGNAATDVLTAEQLIKNFMAE
AAAASPGHSFDFIPSYLPAPRSAQADVLASPGTSEVFSLPERHLQMIY
Download sequence
Identical sequences C5WM46
XP_002467250.1.57931 4558.Sb01g022040.1 jgi|Sorbi1|5029184|Sb01g022040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]