SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5029322|Sb01g025850 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5029322|Sb01g025850
Domain Number 1 Region: 110-202
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000222
Family alpha-D-mannose-specific plant lectins 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5029322|Sb01g025850
Sequence length 249
Sequence
MELLPCIATLLILLSCSLAAATSPLGTIERVTKQQILASIPPVGGAPVLFLTSPSGKYAA
YFVRTHTVPGAGGLGADFCYVEIIDTTTTAASGAHGGTVEGEEEGAAGTSVWESECHPIS
TVNTCALLFSWHGLEVFDGAEEVWHGETNTDGTNFLETLELVDDGDMRIRDKDGELAWRA
SDEPRHAQHCGAPGSPGLAAALPPFAEPLGAHSSNLPFGQEPDGNGHSAELPQAADVGSG
AAAFGAPQG
Download sequence
Identical sequences XP_002464728.1.57931 4558.Sb01g025850.1 jgi|Sorbi1|5029322|Sb01g025850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]