SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5030167|Sb01g040300 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5030167|Sb01g040300
Domain Number 1 Region: 484-714
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-54
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 76-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.67e-23
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5030167|Sb01g040300
Domain Number - Region: 361-424
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000667
Family Hairpin loop containing domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5030167|Sb01g040300
Sequence length 747
Sequence
MCSWRHLALLFLLPCLFGRPSSSAAASDSLSAGDSLTGNRTLVSAGEKFELGFFSPAGNS
TYYVGIWYKRIPGQTVVWVMNRDSPIADPSSAELTVAQDGSLLLLVVTGNRSKKTTVWSS
NSTRPCDEGTAVAVLLDTGNLVLRGRCRRGGNSSAIIWQSFDHPTDTLVPGGWVGLNKST
GAYQALRSWRSATDPSTGLYMDRVDPHGSAQYVFLWNGTTVYHDIGAWNGRYFVPIPEMG
TSPAKYTFVFVNSSDEVSYSFRVVDPSTVSRLVMSPHGQLTMYDWSDASGQWLLHWATPT
SQCDVYSVCGPFGLCDVSSSQYCRCLPGFHPAAQGDWVNQLWSAGCARKTTLQCGGNASS
TDGFLPLQNVQLPGPGSYSLVAAAGSSGDCASACLRNCSCTAYAYADSCLVWDGDLRNVQ
QLSVGDAGASTLFLRVAAADLVAANQRDGRFRIIGVSSAIALAILCLLLFVLARVRRRDE
TVHHDGSLIVFSYGYLAQCTKNYSQKVGMGSFGSVYRGTLPDHTVVAVKRLEGSAQGEKQ
FRTEVRTLGTIQHVNLVRLRGFCATRHERLLVYDYMPNGSLASVLSGHSFRLLDWRARFG
IMAGVARGLAYLHEQCQERIVHCDVKPENILLDAGFCPKVADFGMAKLIGRDFSQALTTA
RGTVREGQFLALLDERLAGDADVEELGRACNVACWCIQQSEALRPTMWQVVQVLEGSLRV
GTAPVPRFLEHLLVEDSCTSYNLELRV
Download sequence
Identical sequences 4558.Sb01g040300.1 jgi|Sorbi1|5030167|Sb01g040300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]