SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5030214|Sb01g041350 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5030214|Sb01g041350
Domain Number 1 Region: 116-394,503-632
Classification Level Classification E-value
Superfamily Subtilisin-like 8.77e-80
Family Subtilases 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5030214|Sb01g041350
Domain Number - Region: 413-477
Classification Level Classification E-value
Superfamily PA domain 0.00288
Family PA domain 0.02
Further Details:      
 
Domain Number - Region: 37-108
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00417
Family Subtilase propeptides/inhibitors 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5030214|Sb01g041350
Sequence length 790
Sequence
MATPRSPFLLLLGLALVALTAPAVLRADGAGEEARKTYIFRVDHRAKPSVFPTHAHWYAS
AAFASSAPGGAAPLQPLHVYGTVFHGFSASVPASRAEELRRHPAVLAAFEDRPRPLHTTR
SPQFMGLRARLGLWSVADYGSDVIVGVLDTGVWPERRSLSDRNLPPVPARWRGGCDAGPG
FPASSCNRKLVGARFFSQGHGAHFGAEAVASNGSVEFMSPRDADGHGTHTATTAAGSVAY
DASMEGYASGVAKGVAPKARVAAYKVCWKGAGCMDSDILAGFDRAVADGVDVISVSIGGG
SGVTAPFYLDPIAIGSYGAVSRGVFVATSAGNEGPTSMSVTNLAPWLATVGAGTIDRNFP
SEIVLGDGRRLSGVSLYSGKPLANSSLPLYYPGRTGGISASLCMENSIDPSLVKGKIIVC
DRGSSPRVAKGMVVKEAGGAAMVLTNGDANGEGLVGDAHVLPACALGEKEGDAVKAYAAN
ASKPTATISFGGTVVGVKPAPVVASFSARGPNGLVPEILKPDFIAPGVNILAAWTGATGP
TGLEGDTRRTEFNILSGTSMACPHASGAAALLRSAHPGWSPAAIRSALMTTAIVTDNRGG
PVGDEAEPGRVATPFDYGAGHITLGKALDPGLVYDAGEDDYVAFMCSIGYEPNAIEVVTH
KPVTCPASTSRANGGSPSGSDLNYPSISVVLRSGNQSRTVTRTVTNVGAQASATYTSRVQ
MASTGAGVTVSVKPQKLVFSPGAKKQSFAVTVIAPSAPATAAPVYGFLVWSDGGGHDVRS
PIVVTWLQPM
Download sequence
Identical sequences C5WR08
4558.Sb01g041350.1 jgi|Sorbi1|5030214|Sb01g041350 XP_002465573.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]