SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5030511|Sb01g047390 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5030511|Sb01g047390
Domain Number 1 Region: 121-396,464-590
Classification Level Classification E-value
Superfamily Subtilisin-like 3.27e-78
Family Subtilases 0.0013
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5030511|Sb01g047390
Domain Number - Region: 79-120
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0017
Family Subtilase propeptides/inhibitors 0.015
Further Details:      
 
Domain Number - Region: 387-454
Classification Level Classification E-value
Superfamily PA domain 0.0759
Family PA domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5030511|Sb01g047390
Sequence length 744
Sequence
MDVARVLLVCHSLFLLLLLPAAVLGAAAETMQTYIVQLHPHDEGGSSEAVLSASKSKVDW
HLSFLERSVAWEQEKRPSSRLLYSYHTVFDGFAAQLADGEAAALRALPGVASVRADRRVE
LHTTYSYRFLGLNFCPTGAWARSGYGRGTIIGVLDTGVWPENPSFDDRGMPPAPVRWAGV
CQGGEHFNASNCNRKLIGARFYSKGHRANYPTNPSEAASLLEYVSPRDAHGHGTHTASTA
AGAAVAGASVLGAGLGEARGVAPGAHVAAYKVCWFNGCYSSDILAGMDDAVRDGVDVLSL
SLGGFPIPLFEDSIAIGSFRATARGVSVVCAAGNNGPARSSVANEAPWVLTVGAATLDRR
FPAYVRLGDGRVLYGESMYPGEIGLKKGGKELELVYAVGGTRESEYCLKGSLDKAAVAGK
MVVCDRGITGRADKGEAVKEAGGAAMVLANSEINRQEDSIDVHVLPATLIGLTNPSVLKP
DVVAPGVNIIAAWPGNLGPSGLESDARRSNFTVLSGTSMAAPHVSGIAALIRSAHPSWSP
AMVRSAIMTTADITDRRGKAIVDGGDGGRAGVFAMGAGHVSPARAVDPGLVYDIQPADYV
IHLCTLGYTHMEIFKITHTGVNCSAALGGDRNRGVFSLNYPSIAVALRNGARSAVLLRTV
TNVGTPNSTYAVQVSAPPGVKVTVAPTTLSFVEFGEQRSFRVTVDAPSPPAAKDSVEGYL
VWKQSGGLGNHVVRSPIAVTWVVE
Download sequence
Identical sequences jgi|Sorbi1|5030511|Sb01g047390 4558.Sb01g047390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]