SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5031176|Sb10g008080 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5031176|Sb10g008080
Domain Number 1 Region: 83-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.06e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.04e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5031176|Sb10g008080
Sequence length 238
Sequence
MSETTEVRLHGAWGSAHAAMARNALALKGVQYEYVEEDLDNKSEALLRLNPVHHGKVPVL
VLVVDGRRRPLAESLVIVEYVDEAWPESPALLPREPRARAAARFWARFFHDEVSPLSRPV
LFADGEAERAELVREMKARMAVMEAGIAEDFPSGDEGPFVHGRSPGLLDVILGSCAAGTR
VLSAVSGEEIVDPWTMPRVHASMAAFDQLAAGFGTTVPHEHLLARLLQRKARPRAAAA
Download sequence
Identical sequences 4558.Sb10g008080.1 XP_002436747.1.57931 jgi|Sorbi1|5031176|Sb10g008080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]