SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5031525|Sb10g014200 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5031525|Sb10g014200
Domain Number 1 Region: 346-636
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-79
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 2-44
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000118
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5031525|Sb10g014200
Domain Number - Region: 228-261
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Pan module (APPLE domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5031525|Sb10g014200
Sequence length 689
Sequence
MQLLDTGNLLVFGKDGSSPLWQSFSHPTDTLLSGQNFVEGMSLVSHSNAQNMTYTLQIKS
GDMLLYAGLQMPQPYWSALQDNRMIIDKNGNNNIYSANLSSGSWSFYDQSGLLQSQLVIA
QQQGDANTTLAAVLGDDGLINFYRLQSVNGKSALPITVPQDSCDMPAHCKPYSICNSGTG
CQCPSALSSYANCDPGIISPCNTKDKFQLVQLDSGVGYVGTRFTSPVPKTNLTGCKNACM
GNCSCIAVFFDQSSGNCFLFDQIGSLQQKDGGKSSFASFIKVSSGNRGTGQGGSDNGRLT
IVIVVIIVGTLAVIGVLVYVGFCIYRRSHHTPSHDAGSSEDDGFLQTISGAPTRYTYREL
QDATNNFSDKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVTIIGSIHHIHL
VKLRGFCAEGAHRLLAYEYMAKGSLDRWIFQRNNDSSLLDWDTRFNIALGTAKGLAYLHQ
DCESKIIHCDIKPENVLLDDNFLAKVSDFGLAKLMTREQSHVFTTLRGTRGYLAPEWITN
YAISEKSDVYSYGMVLLEIISGRKSYDPVEGSEKAHFPSYAFKKLEEGDLRDISDSKLKY
KDQDNRVEMAIKVALWCIQEDFYQRPSMSKVVQMLEGVCDVPQPPISSHIGYRLYTNAFK
SSSEEGTSSGMSDYNSDALLSAVRLSGPR
Download sequence
Identical sequences jgi|Sorbi1|5031525|Sb10g014200 4558.Sb10g014200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]