SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5031759|Sb10g021740 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5031759|Sb10g021740
Domain Number 1 Region: 513-798
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-76
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 120-250
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.28e-26
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Domain Number 3 Region: 141-330,358-410
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000922
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5031759|Sb10g021740
Sequence length 840
Sequence
MCHSKLLLLLFSLLITICSKLANPAMTKSFLANAELGTIWKNNPSVLHNGFPDDNFSVRL
ILPSPYGTARISVGSSVDSVPLFACGFFCAGLAATCDAYIFSIFIVNAFSIGDVLYLESP
QVVWSANHDRPVKENATVQLTELGDLVLYDADGTLVWSTNTTGKSVVGMNLTGSGNLVLL
DHRNMEVWRSFDHPTNTLVTGQVLHLGQKLIASTSATNWAKGKFYLTVLSNGMYAFAGVD
TPLAYYRSPTGGNIIANTSAYIALKNGSLEVFTSFRGTEGPDYLIQFPMNAYGLEFVRLD
WDGHLRLYQGGNGSWVSSDLLDIADPCSYPLACGEYGVCSNGQCSCPDAGLRQSGLFKLI
NPREINRGCVLTDSLSCGSAHKTRFLAVANTTRFKIIYNWTTNEEHCKVSCLNDCSCKVA
FFLHSNSSSGFCFLASDIFSMISISAQSYSRNFSSYAFIKVQEHKPMLSKGKIAIVVVCS
STFVASVIVSMLIVIRRRSAKLLQDRDIIDQLPGLPKRFCFESLKSATGDFSRRIGVGGS
GSVFEGHIGDKKVAVKRLDGINQGEMEFLMEVQTIGSINHIHLVNLVGFCAEKSHRLLVY
EYMPNGSLDKWIFAKHQVGPLDWKTRLKIITDVARGLAYLHSDCRQTIAHLDIKPQNILL
DEMFAAKVSDFGLAKLIDREQSTVMTRLRGTPGYLAPEWLTSIITEKVDVYSFGIVIMEI
LCGRRNLDYSQPEESQHLISMLQERAKGNQLMNLIDPRSTDMEFHIDEVLHTMNLAMWCL
QVDSNRRPSMSMVVKILEGTMSVETELDLDLVNIDLMMANRTSRWDDVTTQVESILTGPR
Download sequence
Identical sequences C5Z4I0
XP_021304362.1.57931 jgi|Sorbi1|5031759|Sb10g021740 4558.Sb10g021740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]