SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5031842|Sb10g022730 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5031842|Sb10g022730
Domain Number 1 Region: 499-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-74
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 63-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-26
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5031842|Sb10g022730
Domain Number - Region: 341-382
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00298
Family Hairpin loop containing domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5031842|Sb10g022730
Sequence length 815
Sequence
MAMGAVSTLVFLLTLIHLILQISALNVLSSGSSLSVERSSDVLLSPDGTFMCGFYNISPN
ASTFSIWFANASERTIVWSANPLRPVYTWGSKVKLKFDGSMVLRDYGGQIVWSNNVSSSN
AEQAQLLDTGNLIVKGKGDTILWQSFTSPTDTLLPTQTINASSKLVAINRLLVPGRYSLH
FDDQVLISLFYDQKDLSFVYWPDPTGTIWQKLRIPFMINTSGVLDSLGQFHGSDNTSFMA
ADWGSHAIRRLTLDYDGNLRLYSLNKADGTWSVTWMAFPQLCTVRGLCGENGICVYTPVP
ACACAPGFEVIDPSERSKGCRPKTNISCDAQKVKFAKLPHTGFNGNDIAAHRFVSLDFCM
NKCLHDCNCKGFAYWEGIGDCYPKFALVGGVTLHHSGTTGTMYIKVSKGVEVLEASIPQS
QPFGPKYGPDCSTTDKYFVADFLDMLKRQQSESKFLYFYGFLSAIFLAEMMFVVLGWFIL
RRERMVLGGVWPAEPGYEMVTNHFRRYTYRELVSATKKFKDELGTGASGIVYKGVLEDNR
AVAVKKLAEINQSEEEFQHELAVISRIYHMNLVRVWGFCSDGPHRILVSEYFEKGSLDKF
LSDRKSSEILLGWKQRFDIALGVARGLAYLHHECSEWVIHCDVKPENILLDENLMPKITD
FGLAKLLNRGGSNINVSKIQGTRGYLAPEWVSSLPITAKVDVYSFGVVLLELLKGARVSD
MENNEDEEVEMVLGRIVRMLNENLQLDGTEQSWISDFIDARLNGDFNYLQARIMMMLVVS
CLEEDRSRRPTMEDVVQMLVSVDEVINATRVEGAF
Download sequence
Identical sequences 4558.Sb10g022730.1 XP_002437195.1.57931 jgi|Sorbi1|5031842|Sb10g022730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]