SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5032014|Sb10g025563 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5032014|Sb10g025563
Domain Number 1 Region: 501-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-78
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 61-155,187-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.24e-19
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5032014|Sb10g025563
Domain Number - Region: 360-399
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00161
Family Hairpin loop containing domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5032014|Sb10g025563
Sequence length 807
Sequence
MASQLAVLIIFLFFLVCSCESLDDRLTSLRPLYPGDKLISDDGGMFALGFFNLTTNSTPS
LYLGIWYNNIPERTYVWVANRDSPITTPSAKLALTNDTSDLVLSDSEGRTVWATDNNVAG
SSSGVLRSTGSFELELQLPNGTGGVVWKSLDHPTDTILPTFRLWTNYKSHTAMRVVAWKG
PRDPSAGDFSLSGDPTGWGLQIIIWRGQSRRRSWRSGVWNGAGASAITRFIYSQIVDDGE
VIYAAYNAAGGPTTHWKLDYTGNVRLRVWNVESSSWTVLFDGPGNGGCLHYGACGPFGYC
DATGREGGVQECRCLDGFEPEDGFFRDFSRGCRRKQALAACGGAGAGGDGRSHYFLTLPG
MKVPDKFLYVRNRSFEECAAECDRNCSCTAYAYANLSSIVTMSASSDMSRCLLWTGELLD
TGKDGDLGENLYLRLAAGSPGNNKKKIGMVMEIVLPTMACLLMLTSCICLATICKSRGTR
RNKEAHERSVHDFWDQNLELSCISFEDLTAATNSFHEANMLGKGGFGKVYKVGILKDGKE
VAVKRLSNGSEQGKEQLRNEVVLIASLQHKNLVRLLGCCLHEDEKLLIYEYLPNKSLDKF
LFDPAMKSMLDWPKRFNIIKGIARGILYLHQDSRMMIIHRDLKASNILLDAEMEPKISDF
GIARIFGSSEQQASTRRVFGTYGYMSPEYTTQGIFSVKSDTYSFGILLLEIVSGLKAWNL
WKDGMARNFVDTMVLESCSLDEALQCIHIGLLCVQDSPNDRPLMSLVVSMLNNEAMSRPM
PRQPLFFAQRYYEALSTRGDSEHSANN
Download sequence
Identical sequences 4558.Sb10g025563.1 jgi|Sorbi1|5032014|Sb10g025563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]