SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5032133|Sb10g027620 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5032133|Sb10g027620
Domain Number 1 Region: 498-801
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-66
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 86-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.19e-26
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5032133|Sb10g027620
Domain Number - Region: 386-426
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0824
Family Pan module (APPLE domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5032133|Sb10g027620
Sequence length 826
Sequence
MASTTLLLVTAVAIIGSARCFAADTITPNSAISGGRTVVSRGGRFELGFFCPAAAGGHRH
SSTNTASCHNYYVGIWYKKAVTPRTSVWVANRAAPVSDPASSQLAVAAGGNLVLTNEAGK
LVWSSNVVISGSSNSLSGTVAVLLDSGNLVLRRHDGGEVLWQSIDHPTDTWLPGGRLGMN
KITGDVQALTSWRSTSDPAPGMYSLGIDPKGASQFFLSWNMTVNFWSSGEWTDDSTFAGV
PEMTSHYKYNFEFVNTSNASYFHYSLQDPTVISRFVGQVRQIMWLPSSDEWMIIWAEPHK
LCDVYAICGAFGVCDDKSVPLCSCPAGFRPSSVEDWELGDYSHGCRRNNPLHCHNSSVRD
DAFLLAPGISLQSSSSSSAAAGASASASSSAQNCRSACLRSCDCNAYSYGSRCALWYGDL
LGLSAMDTTSSSTDDLYLRLSAMDVPSNGRNRTVVVFVSVASAASILSVIATVLLVKMFR
RRQRSIRFMQAAAEGGSLVAFKYSDMRRATNNFSEKLGGGSFGSVYKGTLSRVGAAIAVK
RLEGVLCVGEKQFRNEVRTIGSIQHVNLVRLRGFSSHGSERLLVYDHMPNGSLDRALFAP
APAPALSLCWRARFQIALGAARGLLYLHEGCRDCIIHCDIKPENILLDVNLVPKIADFAA
GEGFQQGVLTTVRGTIGYLAPEWISGVPITAKADVYSYGMVLLEIISGRRNARGWPTTEQ
EGSSLSGYFPLVAATKVNEGEALVGLLDERLRGDADARELERACRVACWCVQDDEAHRPS
MEQVVQALEGVVTLNVPPIPTSLQTGAFAGDAAFVSTPTSAYFDGL
Download sequence
Identical sequences C5Z879
4558.Sb10g027620.1 jgi|Sorbi1|5032133|Sb10g027620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]