SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5033018|Sb02g008355 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Sorbi1|5033018|Sb02g008355
Domain Number - Region: 44-97
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0445
Family SGL-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5033018|Sb02g008355
Sequence length 129
Sequence
MGAREVGWVDLPPECSCRSCRILLTTTEHGGLGIVRVEKNSRLHLWSREAGPNGVLRWAP
SGVIELETVLPDNSGSIFIVAFVHGLGALFVMTKNAGAFTIDLVFNRVRKVCGNSSVNYF
VPYTSFCTP
Download sequence
Identical sequences 4558.Sb02g008355.1 jgi|Sorbi1|5033018|Sb02g008355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]