SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5033178|Sb02g010550 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5033178|Sb02g010550
Domain Number 1 Region: 273-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 508-575
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5033178|Sb02g010550
Domain Number - Region: 165-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00862
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5033178|Sb02g010550
Sequence length 579
Sequence
MAAAKPQLQFSPHAAASPADADAGPADADAGFAVFRLLLPPSFSDADTMRLYAAVNPLRR
RTAALQVRVEPLDPASAGGRVVAAVLGPTAPVRRVEASSSSAEPLALSPAQEALVAVIDT
QGALYCAGEEEARGKAPPGRVTCLLLVDADRLEASAGRGVMERIALEAGADVRVAMWEEG
ALPPRGQPPEEVVEITGDRTAVRKALVALSSCLQGDLPIGNSTAYDKKEGSILPWASSEV
PGPNMGTSCSEVSTEFAQGSVAKTHCPEGNTGYVQSKTLQQVSFRLLLPTYLAGGLIGKR
GLIIKGIEDETGACIDVGAPVTGCKERVITICALEITGEQVNIRNALSLVCWKLRNHIFS
NETDYNNSHISSSEIASSNATNQANNYSTSQYSMDNAHKVDHGPSLSYGVDSVEKSFSDL
ELSSSEIQLGSLGVQGLKVRGSNSHHFEPMGRMKPDNGNGVRINNSDSGIQNPTEWNDIV
TNNLNHGIIFSEENNLVRGVEHASITRITYETAVSGSILTLVYGDNGSNLAKLTEVSGAD
IAVYNPPSEGNEAMIVVSGPPDQAQSAQRLLVELILQGQ
Download sequence
Identical sequences jgi|Sorbi1|5033178|Sb02g010550 4558.Sb02g010550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]