SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5033933|Sb02g026520 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5033933|Sb02g026520
Domain Number 1 Region: 514-760,790-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-73
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 81-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-19
Family alpha-D-mannose-specific plant lectins 0.0067
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5033933|Sb02g026520
Domain Number - Region: 369-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000282
Family Pan module (APPLE domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5033933|Sb02g026520
Sequence length 904
Sequence
MSPLPPALPRSLAFLGLALILLPARAADAGPLTTELLRPPFTASNILYVDTDGAFLESKN
GAFKAAVWNPGQGEQQDRFYLVVLHAPSATVVWSGNRGAPTTSSGSVKLTSQGLTVSNPD
GTVLWSTPPQLPSPVVALRLLDSGNLQLLDAGNATLWQSFDNATDTLLPGQQLRAGAYLS
AATSATDLAEGNYRLGVTTADLVLTWQASTYWRLSNDVRSYKDRNAAVASVSVNASGLFA
VAADGGLVFRVDLGEAAFPVLKLGYDGRLRITSYPLVNSSAPLGSDFVAPANDCDLPLQC
PSLGLCSPSGNSSTCTCPPLFAASATTPGACTPGDGSALASPALCQSSNSTVSPAYLALK
SKAAYFATKFDPPIKTGVNHNACRGLCSTSCGCLAYFYDNSSLSCYLIQEKQLGSLYLSS
SASAMGYIKTIPSPNNATRNNSSSSSANRVVPIVLPSIAAFLLLTVIACYACWRRMRNNG
KKRKGRSPGVKQVYMGRQKDTGNADDDEDDDNVRVPGMPTRFSYAEIEAMTSNFETKIGS
GGFGSVYKGELPGVEGLVAVKKLEAVGVQAKREFCTEITVIANIRHVNLVRLRGFCAEGS
RRLLVYEYMNRGSLDRSLFGRTGPVLEWGERMEVALGVARGLAYLHTGCDQKIVHCDVKP
ENILLADGGQVKVADFGLAKLMSPEQSALFTTMRGTRGYLAPEWLSNAAISDRADVYSFG
MVLLELIHGRKNRGEQTNDGVAAAVAVAVAGSSVHSDWPSGWSSATAVSSPSGASGSGDE
YFPMVAMELHGQGRHLDLVDPRLEGRVEEAEAARAVRIALCCLHEDPAQRPSMAAVVRML
EGTVAPPEPRVEALGFLRLYGRGHAVPNTSLIAMAGTSGSAGTPSSTAGVSQLTDTLQSV
SAPR
Download sequence
Identical sequences C5X2A2
4558.Sb02g026520.1 XP_002460325.1.57931 jgi|Sorbi1|5033933|Sb02g026520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]