SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034027|Sb02g027810 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034027|Sb02g027810
Domain Number 1 Region: 165-374,488-615
Classification Level Classification E-value
Superfamily Subtilisin-like 4.06e-66
Family Subtilases 0.0086
Further Details:      
 
Domain Number 2 Region: 392-467
Classification Level Classification E-value
Superfamily PA domain 0.000000994
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034027|Sb02g027810
Sequence length 787
Sequence
MDGGLQSTEKGLLNPRLRLPRPELAQAHRVVVRPSVPGGATATGTVAGAGGSRQGIPHVE
SSPIHRAGWQAGCSPPAVPPSVFSLSHPPRLPTAVPRAPCAVYGGLQYSRGHARVRRERD
DQLNKASCSCAGVWPEAGSFRDDGMGPAPTRWRGICQDQQASDDAQVRCNRKLIGARFFN
KGYLATVGQQQQQQASPASTRDTDGHGTHTLSTAAGRFVRGANLFGYGNGTAKGGAPRAH
AAAYKVCWRPVNGSECFDADIIAAFDAAIHDGVHVLSVSLGGSPANYFRDGVAIGSFHAA
RHGVTVVCSAGNSGPAAGTVSNTAPWLLTVGASTMDREFPAYLVLDNNKRIKGQSLSPTR
LAGNKYYQLISSEEAKGANATVTQAKLCIKGSLDKAKVKGKIVVCTRGNNARVEKGEAVH
RAGGAGMVLANDEASGNEMIADAHVLPATHISYTDGLELLAYLNSRRSASGYITVPYTAL
DTKPAPFMAAFSSQGPNTVTPQILKPDITAPGVSILAAFTGQAGPTGLAFDDRRVLFNAE
SGTSMSCPHVAGIAGLLKALHPDWSPAAIKSAIMTTARVQDNMRKPMSNSSFLRATPFGY
GAGHVQPNRAADPGLVYDANATDYLGFLCALGYNSSVIATFMGGAGGDGDGDGHAAHACP
ARRVPRPEDLNYPSVAVPHLSPTGAAHTVTRRVRNVGPGAGAATYDARVHAPRGVAVDVR
PRRLEFAAAGEEKQFTVTFRAREGLYLPGEYVFGRLVWSDGPGGRHRVRSPLVVRVVDTK
KKSLSVA
Download sequence
Identical sequences 4558.Sb02g027810.1 jgi|Sorbi1|5034027|Sb02g027810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]