SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034088|Sb02g028920 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034088|Sb02g028920
Domain Number 1 Region: 75-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 295-365
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.3e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 3-78
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000092
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034088|Sb02g028920
Sequence length 371
Sequence
MIILNEMVGSIIGKGGSTIRALQSETGACIKILELVADSDERVVAISARENSDMMHSPAQ
DAVVRVYSRISEASMDRSSPTPARLLVPSQHIGCLLGKGGSIITEMRKITGASIRIFGNE
QIPRCAQRNDEMVQVTGSFQSIQDALLHITGRIRDVILPKPHPSGGMPPYPPVGNIPVHQ
SRQEPPPPHLHPSGGMPPYPMHSFRPDAPMGHFETGDHRPPPVHSMEYMGADRMPYSYGG
EQGGPRPFLEQPSPRTWPPEAPRTNSEAPRNMPDAVLATDLRKGPVASENQVATPTSTTT
EVVIPCKYIGFVCGNSGSEIEEIRQMSGASITVHDPKPGDTNSIVVICGDPEQTKKAQSL
IHAFIFCGLQT
Download sequence
Identical sequences jgi|Sorbi1|5034088|Sb02g028920 4558.Sb02g028920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]