SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034255|Sb02g032060 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034255|Sb02g032060
Domain Number 1 Region: 492-778
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-78
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 61-155,187-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-30
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034255|Sb02g032060
Domain Number - Region: 274-320
Classification Level Classification E-value
Superfamily Ribonuclease Rh-like 0.0297
Family Ribonuclease Rh-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034255|Sb02g032060
Sequence length 801
Sequence
MAFMSSISLYIAALLLFAALCTSDDRLVPDKPLLPGTTIISDGGEFAFGFFAPSNSTPEK
LYLGIWYNNIPRFTVVWVANRATPAISSSTPSLVLTNNSNLVLSDANGRVLWTTNTTTAP
RSNSTTGLVLMNTGNLVLRSPSGKILWQSFDHPTDTLLPGMKIWRSHKTDEGNRLVSWKD
PEDPSTGTFSFGVETDLFVQPFIWNGSRPLWRSSVWTGYTISSQVYQLNTSSLMYLAYVD
TVDEISIVFTMSEGAPPMRAVMSYSGRMELLGWNRNLSDDWTVHITWPDSSECSRYAYCG
PSGYCDYTEATPACKCLDGFQPTDEGEWSSGKFSQGCRRKDPLRCSDGFLAMPGMKVPDK
FVRIRKRTLVECVAECSSNCSCLAYAYANLNSSESNADVTRCLVWIGDQLVDTQKIGMMS
SYFFNTAGAEAEETLYLRVANMSGKRTKTNATKIVLPIFISAILLTSILLVWICKFRDEI
RERNTSRDFELPFLKFQDVLVATNNFSPTFMIGQGGFGKVYKGALEGGQEVAIKRLSRDS
DQGIQEFRNEVILIAKLQHRNLVRLLGCCVEGDEKLLIYEYLPNRSLDAMIFNQERNARL
DWPIRFKIIKGVARGLLYLHHDSRLTIVHRDLKASNILLDAEMRPKIADFGMARIFGDNQ
ENANTRRIVGTYGYMAPEYAMEGIFSAKSDVYSFGVLVLEVAWSLWKEGKAKDLIDECID
ENCLQDEASLCIHIGLLCVEENPEDRPFMSSVVFNLENGYTTPPAPNHPAYFAQRNCDMK
QMQENILTSKNTVTLTVIEGR
Download sequence
Identical sequences jgi|Sorbi1|5034255|Sb02g032060 jgi|Sorbi1|5034262|Sb02g032110 4558.Sb02g032060.1 4558.Sb02g032110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]