SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034260|Sb02g032075 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034260|Sb02g032075
Domain Number 1 Region: 62-135
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000561
Family alpha-D-mannose-specific plant lectins 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034260|Sb02g032075
Sequence length 141
Sequence
VTFHLHHSHSRRRAPPPLAALLLTGRGQVNPRGVADTGETIGHGGAFVLGFFTPSNATPG
GQYVGIWYNNIPVQTVVWVANWDAPVIVDERSGNNSSSSTLPPPSLALANDTTTTNIVLS
DAAGRVVWTTNVVTAATTTTC
Download sequence
Identical sequences jgi|Sorbi1|5034260|Sb02g032075 4558.Sb02g032075.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]