SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034263|Sb02g032120 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034263|Sb02g032120
Domain Number 1 Region: 494-783
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-78
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 66-179,211-240
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.37e-23
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034263|Sb02g032120
Domain Number - Region: 388-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0746
Family Anti-platelet protein 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034263|Sb02g032120
Sequence length 828
Sequence
MEWSRSTCITVTAAAVLLLLLPRFCSPAGDKLTQGESLTPGETIVSDGGAFVLGFFAPSN
ATPGRQYVGIWYNNIPVQTVVWVANRDAPVTVDERSGNNSSSSAPPPPSLALANDTTTTN
IVLSDAAGRVVWTTNVVTAATTTTSSGGSTTAVLLNSGNLVLRSPNGTTLWQSFDHPTDT
FIPDMKVGLRYRTHDGARIVSWRGPGDPSPGTFSYGMDPSTSLQMLVWNGTRAYWRSSAW
TGYMTVSRYHATTGTVIYVAVVDGEEEIYMTFYVNDGAPPTRYVVTGDGRFQLLSWNRNA
SAWTTLESWPSRSCSPYGSCGAYGYCDNTLPVATCKCLDGFEPASQAEWSGGVFSAGCRR
SQALAPCGEGDAFLAMPNMKVPDKFVLLGNMSSGDECAAECRRNCSCVAYAYANLRSSSA
KGDIARCLVWTGELVDTQMIGVLWGITAETLHLRVPAGITDKKRSNESEKKLVPGSSVRT
SSELAERTPNPNEDLEFPSMQFSDIVAATNNFSRACMIGRGGFGKVYKGTLLGGREVAVK
RLSKDSEQGIEEFKNEATLISKLQHRNLVRLLGCCTQGAERVLVYEYLANKGLDAILFDS
ERKSLLDWPTRLGIIKGVARGLLYLHQDSRLTVIHRDLKASNVLLDAEMRPKIADFGMAK
IFGDNQQKANTRRVVGTYGYIAPEYQTEGVFSVKSDVYSFGVLVLEIVSGIRISSTDNIN
GSPGLVAYAWKLWNEGNAWDLVDSSVAESCALDEALLCVHVGLLCVQDDANGRPLMSSVV
SILENGSVSLPAPEQPAYFAERNCNKSLEGDDVQTSRNSMTMTVLQGR
Download sequence
Identical sequences jgi|Sorbi1|5034263|Sb02g032120 4558.Sb02g032120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]