SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034264|Sb02g032130 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034264|Sb02g032130
Domain Number 1 Region: 489-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-68
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 77-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-27
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034264|Sb02g032130
Domain Number - Region: 367-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00745
Family Hairpin loop containing domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034264|Sb02g032130
Sequence length 786
Sequence
MSWLDISYATTVLLLLASPCATDDRLVPGKPLSPGATIVSDGGSFALGFFSPTNSSSTPD
KLYLGIWYNDIPGRLTVVWVANRETPVTASPPASLSLTNASNLVLSGADGRVLWTTTDVA
GAGAAAATSNTAAAVLLNTGNLVIRSPNGATLWQSFDHPADSFLPGMKIRVNYKTRAGNR
LVSWRSPDDPSPGVFSYGGDPDTFLQIFIWNGTRPIMRSAPWDGEPVTAGLVRLSTTSVI
FYQTVVSTQEEIYLTFSVSDGADHTRYVLTDSGELLFQSWNSSSSAWDVLGGSSDPGCNL
YGYCGPNGYCDNTESPRSRCKCLDGFEPVAGLEDWNSGRFSQGCRRKEELRRCGGDRFLA
LPGMQSPDKFVHVENRTLQECAEECTRNCSCVAYAYANLSTSRNKGDLTRCLVWAGELID
TWKSDTDTLYLRIAGLDAGTRAKSNIVKIVAFPLHGSSCSKVQPSIAVFFCVPILLFDSK
DWLYNIEQAMLSGHEVAIKRLSKDSEQGSKEFRNEVILIAKLQHRNLVRLLGCSIDIDEK
VLIYEYLPNGSLDATLFDNSRKMLLDWPIRFNIIKGVARGLLYLNQDSRLTIIHRDLKAA
NVLLDGQMRPKIADFGMARIFNDSQEDANTHRVVGTYGYMAPEYAMEGVFSIKTDVYSFG
VLLLEVVTGIRRSSISSTMGFQNLIIYAWNMWKEGKARDLVDPSIMDTCLLDEVLLCSHV
GLLCVQENPVDRPLMSSIVYSLENASIALPPPNNPGHYGQRSGDMRQIRDEDNSMNSLTI
TTIEGR
Download sequence
Identical sequences jgi|Sorbi1|5034264|Sb02g032130 4558.Sb02g032130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]