SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034265|Sb02g032135 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034265|Sb02g032135
Domain Number 1 Region: 33-113
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-22
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034265|Sb02g032135
Domain Number - Region: 316-352
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0012
Family Hairpin loop containing domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034265|Sb02g032135
Sequence length 394
Sequence
MTHVLCVGCALHLASDRVYRILSDRGSPATATSGTSSAPPSLTLTNSSNLILSDASGRVL
WTTNVTGTVSGSAATAVLLNTGNLVIRSPNGTTAWQSFDHPGDTFLPGMKIRVTGTGLAT
ASSSFLGKALTSPRRGASASAWTRARSCRPSSGTGRVPWRAPSRGRATRPSVATGQFQVN
SSSSVVMVSLAVVRTGQEMYLAYSLPDGSAHAHTRFVLTYSGEYQLQSWGSSDWAVVGKW
PANACDFYGQCGPYGYCDGTVSAPMTTPTCKCLDGFEPASLEEWSRGRFSQGCRRKEALP
LRCGHGGFVALPGIKPPDKFVVVENRTSEECAMECTKNCSCMAYAYANLSSRGTMGGMRC
MVWAGELIDTERVGDTAGSDTLYLRTADLDAGVM
Download sequence
Identical sequences 4558.Sb02g032135.1 jgi|Sorbi1|5034265|Sb02g032135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]