SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034266|Sb02g032145 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034266|Sb02g032145
Domain Number 1 Region: 59-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.46e-19
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Domain Number 2 Region: 442-508
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000365
Family Protein kinases, catalytic subunit 0.0055
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034266|Sb02g032145
Domain Number - Region: 339-371
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00231
Family Hairpin loop containing domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034266|Sb02g032145
Sequence length 534
Sequence
MSLTACTVLSFLFLLLPSCASQDKLVVGKPLSPGDVIVSSDGTFALGFFNSSSSTPAKLY
LGIWYYGIPKLTVVWIANRDTPIISATGRSSSSAPTLALTNTSNLVLSDADGGGVWSTNV
NAGAVAVGSSQQPGAAGTAATLTNTGNLEIRSPNGTMLCQSFDHPTDTFLPGMKVRASRG
DRFVSWKTLWRSGAWTGYRVATEYVASISTVVSFAVVDDAYMSFSVSLGAPRMRYVMSYS
GELVLRSWNRTTLEWDDIDVWPPYDCSRYGYCGPFGYCDNTGAAAPACRCLDGFEPTSAE
EWGNGRFSQGCRRKEALRCGDGDGDGFLALPAMKAPDRFVVVGNRSLDECAAECSRNCSC
VAYAYAKRSSSANGDLTRCLVWVGELVDTEKKNSNVVGTEILYLRLAGLEKKGNKQKLGK
HKMLVLGDLSAPEGFVQGSTEGYKFPVVSFRDIIAATDNFHESYMIGQGGFGKVYKAKLD
GQEVAIKRLSRDSEQGIAEFRNEVVLIAKVLEIVSGVRINSTNQTMEFEDLIDY
Download sequence
Identical sequences 4558.Sb02g032145.1 jgi|Sorbi1|5034266|Sb02g032145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]