SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034334|Sb02g033290 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034334|Sb02g033290
Domain Number 1 Region: 491-778
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-75
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 66-160,192-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-29
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034334|Sb02g033290
Domain Number - Region: 355-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00053
Family Pan module (APPLE domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034334|Sb02g033290
Sequence length 801
Sequence
MRLLHVLLLLLLLSLHAAPRPCSAATTATDTVSPGNALAGTAARLVSNNSKFALGFFKTD
TASPNTYLGIWFNKVPKLTPLWSANGESPVVDPASPELAISGDGNLVIRDQATRSVIWST
RANITTNATVAVLLSSGNLVLRSSTNSSHVFWQSFDYPTDTLFAGAKIGWNRRTGLNRRL
VSRKNALDQAPGLYSLEMTERDGVGHLLWNSTVAYWSSGGWNGNYFGLAPEMIGAVMPSF
RFVNNDDEISFMYTLHDDTAIVHTALDVSGQGLVGFWLDGKQDWLINYRQPVVQCDVYAT
CGPFTVCDDAADPTCSCMKGFSVRSPRDWELGDRRDGCARNTQLDCDTNRTGLSLTDKFF
AVQGVRLPQDANKVQAAKSGDDCAEICLGDCSCTGYSYWNGGCSVWHGKLYNVKQQSDAS
ANGNGETLYIRLAAKEVVASGVARRKRGISVGVATGVAVGASAAALILVAILGVMIWRRK
GKRIENPQGGIGIIAFRHVDLQRATRNFSERLGGGSFGSVFKGYLGDSVALAVKRLDGAH
QGEKQFRAEVNSVGIIQHINLVKLIGFCCEDDKRLLVYEYMPNHSLDVHLFKANGTVLDW
NLRYQIAIGVARGLAYLHTGCRDCIIHCDIKPENILLDASFVPKIADFGMAKVLGREFSN
AITTMRGTIGYLAPEWISGTAVTSKVDVYSYGMVLFELISGRKNSSPEYFGDGDYSSFFP
MQVARKLRSGEVGSLVDEKLHSDVNLMEVERVCKVACWCIQENESARPTMAEVVQFLEGL
SELGMPPLPRLLNAVTGGSPT
Download sequence
Identical sequences C5X8J9
jgi|Sorbi1|5034334|Sb02g033290 XP_002460694.1.57931 4558.Sb02g033290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]