SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034388|Sb02g034410 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034388|Sb02g034410
Domain Number 1 Region: 477-763
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-80
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 94-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000102
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034388|Sb02g034410
Domain Number - Region: 363-399
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0745
Family Pan module (APPLE domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034388|Sb02g034410
Sequence length 793
Sequence
MEAVKRVCSLSQPPLATFFFLAVAAFAARDTILPGEGISGNQTLVSRNGVFELGFFSPGT
DIYHFLGVRILNMPTNAGTPKFWFGDRVYISDLPSAALQLFGDRLYITENGTNLWWSSVA
GAGGGPAAPTASVVAVLLDSGNLVVRDQANSSRVLWQSFDYPGDALLPGARLGLDGDTGN
NVSLTYTNTNSWHNSSLSVDPDRRRRNGFVLATDGWDVLRGTFPEWMVSSQGNGSSLVLL
NNRPGAGMAEHLQLHLGQVSLRSWSSSAGCWVASWTFPSDCKSSAFFCGRFGACTSNGTC
GCVDGFEPANPSEWQRGYFVNGCSRSLPLSCTADNGGRLTAEHDDSFVLLDNLQGLPYSS
QNATAEGDEGCRQACLSKCYCVAYAYDDDDDSGCKLWFNYLYNVSFAATPPYSKVYVRLG
SKLMAQKASKTVGIVFMVVGLTAAVCVILILALLWRYRGGFLSTTACRKFQEVEGGSLAV
YTYAQVRRATRNFSDEHKLGEGGFGCVFRGTMPGPTVVAVKRLKGFGQADKQFRAEVQTL
GVIRHTNIVPLLGFCVTGSRRLLVYQYMDNGSLGAHLFPENKPCLLNWDLRYRIAHGIAK
GLAYLHEECEDCIIHCDIKPENILLDAEFRVKIADFGMAKLLGREFSSALTTIRGTMGYL
APEWVSGQPITKKADVYSFGIVLLEIISGRRTIRRLKFGSHRYFPHYAAAQLNEGNVMSL
LDRRLGGNASVEELDVTCRVACWCIQDEEDDRPSMAQVVRMLEGVLDTGIPPVPSSFMNL
IEGESSSTSSEEG
Download sequence
Identical sequences C5X9Y1
4558.Sb02g034410.1 jgi|Sorbi1|5034388|Sb02g034410 XP_002462917.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]