SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034471|Sb02g035920 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034471|Sb02g035920
Domain Number 1 Region: 488-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-80
Family Protein kinases, catalytic subunit 0.0000745
Further Details:      
 
Domain Number 2 Region: 79-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-29
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034471|Sb02g035920
Sequence length 823
Sequence
MAAGARPPLALLLPLFVTFFFSSPSSASAADTLAANSSLSDGQTLVSATGVFELGFFTPV
SSTARFLGIWYMGLAPQTVVWVANREAPINATTASLAINGTGSLVLADASSGQVFWSSNV
SGTGAAAGPVAAQLLDSGNFVLQGAGGAVLWQSFDYPSDTLLPGMKLGWDLTTGLNRYLT
TWRSPGDPSPGDYTFGFDLRGVPEGFIRRDDDTTPVYRNGPWNGLQFSGEPEMEPNNSNF
LFQFVDNASDVYYTFLVDNSSGGVVSRFVLNQSSVQRYVCPEGGQGWSLYWSLPRDQCDN
YGHCGDFGVCDTSSGSPACACVHGFTPASPRDWELRDSSAGCRRVTPLNCTGDGFLQLRG
VKLPDTTNATEDAAITVDRCRQRCLANCSCLAYAASNIKGGDSGCIIWSSLLIDIRHFSS
GGQDLLSAILLFGFGGFFIWIKFFRNKGRFQSAQRFNSFDSTVPLAPVQVQDRSKGKEDE
AGQNSDLNVTLFDMDAIAFSTDNFSAWNKLGEGGFGPVYKGHLEGGQTVAVKRLSKYSTQ
GLSEFKNEVMLIAKLQHVNLVRLLGCCVHGEERILVYEYMENKSLDNFIFDKNRSSQLHW
SKRFDIILGIARGLLYLHQDSRYKVIHRDLKAGNILLDKDMNPKISDFGVARIFGDDTDS
RTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGRKNRGMYSSGEQTSLLSQA
WKLWREGNALALLDEAVARAGAHRSSEVLRCVQVALLCVQERPDDRPHMAAVFLALGNPG
AVLPQPRHPGYCTATDRGSASTDGEWSSTCTVNDVTVTIVEGR
Download sequence
Identical sequences jgi|Sorbi1|5034471|Sb02g035920 4558.Sb02g035920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]