SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034472|Sb02g035940 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034472|Sb02g035940
Domain Number 1 Region: 529-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-80
Family Protein kinases, catalytic subunit 0.0000821
Further Details:      
 
Domain Number 2 Region: 79-179,214-243
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.11e-21
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034472|Sb02g035940
Domain Number - Region: 315-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0165
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034472|Sb02g035940
Sequence length 864
Sequence
MVGMKPGGGVLRFSSTMAPSPPRLLFPLLASLCCAVAAQTTDTLRQGQSLSGAATLVSSP
EGVFELGFFAPDTNQPSRQYLGIWYHGISPRTVVWVANRVAPATSALPSLALTVTGELRV
LDGTTANGTADAPLLWSSNATSRAAPRGGYSAVLHDSGNLEVRSEDDGVLWDSFSHPTDT
ILSGMRITLQTPGRGPKERMLFTSWASETDPSPGRYALGLDPNAQAYIWKDGNVTYWRSG
QWNGVNFIGIPWRPLYLSGFTPSNDPALGGKYYTYTATNTSLQRFVVLPNGTDICYMVKK
SSQEWETVWYQPSNECEYYATCGPNSLCTALQDGKAKCTCLKGFRPKLQEQWNAGNWSQG
CIRSPPLGCEANQSGDGFLPMRNIKWPDLSYWVSTVADETGCRTDCLNNCSCGAYVYTST
TGCLAWGNELIDMHELPTGAYTLNLKLPASELRGHHPIWKIATIASAIVLFVLAACLLLW
WKRGRNIKDAVHRSWRSRHSSSRSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLERIK
AATSNFSDSNKLGEGGFGPVYMGTFPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHR
NLVRLLGCCIQREEKILVYEYMPNKSLDAFLFNPEKQGLLDWKKRFDIIEGIARGLLYLH
RDSRLRVVHRDLKASNILLDADMNPKISDFGMARIFGGDQNQFNTNRVVGTFGYMSPEYA
MEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDKAAELIDPVI
RASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLMLRGREIE
SSKSSEKDRSHSIGTVSMTQLHGR
Download sequence
Identical sequences C5XAX0
XP_002462992.1.57931 jgi|Sorbi1|5034472|Sb02g035940 4558.Sb02g035940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]