SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034994|Sb03g001300 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034994|Sb03g001300
Domain Number 1 Region: 465-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-79
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 107-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000851
Family alpha-D-mannose-specific plant lectins 0.0078
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5034994|Sb03g001300
Domain Number - Region: 364-406
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0212
Family Hairpin loop containing domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034994|Sb03g001300
Sequence length 780
Sequence
MEAAKLGCSPSGPRGWAPPNFRFLFLLLAAAAASATDTILPGAGISGNQTLVSKNGDFEL
GFFAPGAGIHRFLGVRFKRMPSTSPTFWVGDRVVISDLSAAALEVFAGGLCITEAGSTLW
CSPVPGDVPGAPPPAAAVLLGNGNLVVRDQANASRVLWQSFDSPGDSLLPGARLGLVDDT
GANVSLTYKDYSHNGSVSVDRSRRNGFVLTTDGHSTLGTFPDWMVTSQDNGSSLVLNPPD
NLNLTEFLQFHLGQVSLMRWSEDSGAANSSGWVARWTFPSDCKSSGFFCGNFGACTSNGR
CDCVDGFEPSYPAEWNLGSFATGCSRPRSLPLSCETDGQTEHDDSFILQDKLQGLPYDSQ
NDLAGSDEDCKQACLSKCYCVAYVYDSGCKLWYYNLYNLSFASRPPYNKVFVRWGSKLKA
KNGLHTGLIVFLVVGLVALAAVISVLVLLWRYRRDLFTCRKFEVEGSLVFYSYAQVKKAT
RNFSDKLGEGGFGSVFRGTMPGSTVVAVKSLKGTGQEDKQFRAEVQTVGVIKHANLVRLL
GFCVKGDMRLLVYEYMPNGSLDSHLFSERSSLLNWDLRFQIALGIAKGLAYLHEECEDCI
IHCDIKPENILLDSEFCAKISDFGMAKLLGREFNSALTTIRGTMGYLAPEWISGQPITKN
ADVYSFGIVLLEIISGRRTTKRLKFGSHRYFPLYAAAQVNEGNVLCLLDGRLEGNANVKE
LDVACRVACWCIQDEENDRPSMGQVVRMLEGVVNTEIPPIPSSFQNLMEGENSSIYSDEG
Download sequence
Identical sequences 4558.Sb03g001300.1 jgi|Sorbi1|5034994|Sb03g001300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]