SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5034995|Sb03g001330 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5034995|Sb03g001330
Domain Number 1 Region: 464-746
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-76
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 87-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-16
Family alpha-D-mannose-specific plant lectins 0.0088
Further Details:      
 
Domain Number 3 Region: 344-376
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000726
Family Hairpin loop containing domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5034995|Sb03g001330
Sequence length 781
Sequence
MVDTSSLRFFYSTSFALLLPSLTCLVFPCCKLTCALDTLLPGQFLNENQSLISKNGAFKL
GYDCYIPQGYCGLGIWFAKPSSCNREYFPLWQPDAYSYDRASFILSVSDNGVLNYTIYGG
DIWSTPVTRTTSISAAAVLLGNGNLVIRDRVNSSMVIWQSFDNPTNVLLPGQHLGFNKIN
GKKITLCSSLDPYGMGLTFTLSLDATRRRSFIIRQHPNGQMFAGTFPGWMGIHEDGDHML
TFNDVYAYIRLNESGFVTFAKQRECDSILWSAPESLCEFHSYCGPYSLCTLSGSCICPVG
FNSLSSNAAWISTGCLRDYPLNCENGEVTCYPIDGIHRYPQKAFTLEVTNMSECESACLR
DCTCTAFAYNASCLLWFRELRSTIVLDSDLNGNRLYICRSTKQQSGSRIVPWNGSSKERI
VPWKRLVLESMIGVIAVIVMSLILLLRCRQKLLKARTVGGSGSLMVFSFVQIKNSSKQFS
EKLGEGGFGCVFKGMLPSCTMVAIKKLKGLRQEDKQFRAEVQTIGMIQHINIVHLLGFCA
EGSGRFLVYEYMANGSLSNHLFSENSFKLSWELRYSIALGIARGLAYLHEGCKDCIVHCD
IKPDNVLLDAEFCPKIADFGMAKLLGRDYSRVLTTMRGTIGYLAPEWITGVPITHKADVY
SYGMVLLEIISGRRNSEKIKEGRFTYFPIYAAVKVNEGGIMCLLDSGLKGNADAEKLERA
CRVASWCIQDAEDHRPMMGQVVRMLEGVMDVQVPPVPRSLQNYVGMEDSTSADFYISEVS
C
Download sequence
Identical sequences C5XKC4
4558.Sb03g001330.1 XP_002457107.1.57931 jgi|Sorbi1|5034995|Sb03g001330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]