SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5035227|Sb03g005540 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5035227|Sb03g005540
Domain Number 1 Region: 521-776,804-867
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-72
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 64-172,204-240
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-23
Family alpha-D-mannose-specific plant lectins 0.0076
Further Details:      
 
Domain Number 3 Region: 377-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000017
Family Anti-platelet protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5035227|Sb03g005540
Sequence length 881
Sequence
MSVALPTTLVVLGLLSACRSAATTDTLSPGQVLAGDATLVSNNTKFTLGFFKAPDGAAAG
SPDRWYLGIWFTAVPDRTTVWVANGANPVIDADAGSPELTVSGEGDLAVVNQATKSVTWS
AHNNTTAAANTSTTTAIAVLLDSGNLVLLDVSNSSAAAPRRTLWQSFDHPTDTLLPSAKL
GLSKATGVTTRLVSRRSSATPSPGRYCFEVDPGAPQLVLKLCGDSSSSVSVAYWATGAWN
GRYFSNIPELAGDVPNFSLAFVDDATEEYLQYNVTTEATVTRNFVDVTGQNKHQLWLGAS
KGWLTLYAGPKAPCDVYAACGPFTVCSYTAVELCSCMKGFSVSSPVDWEQGDRTGGCVRD
APVNCSAGSSNGSRAPSSTDGFFSMPGIRLPDNGRTLQNVRSSSECSTACLNNCSCTAYS
YGGNQGCQVWQDGLLEAKQPQSNGGGDSVSDVGTLYLRLSAREFQTSGGGGTNRGVIIGA
VTGACTAALILLVLAIALIIRRRKNTKQNDRGGVAAGGGLTAFSYRELRSATKNFSEKLG
QGGFGSVFKGQLRDSTAVAVKRLDGSFQGEKQFRAEVSSIGVIQHVNLVRLVGFCCEGES
RFLVYEHMPNRSLDIHLFQRSGGGGGGGVFLDWSTRYQIAVGVARGLSYLHDGCRDRIIH
CDVKPENILLGASMLPKIADFGMAKFVGRDFSRVLTTIRGTKGYLAPEWISGTAVTPKVD
VYSYGMVLLEIVSGRRNSAAGEEDYRTAGGSENGGDDAGEEEEEEVAFFPMKAARELVKG
PGVVSVGNLLDDKLCGDADLVEVERACKVACWCIQDDEADRPTMAEVVQVLEGVLDCDMP
PLPRLLATIFGRPHSSTEQQTTSVSDTSTLAPFTSGSGSLN
Download sequence
Identical sequences 4558.Sb03g005540.1 jgi|Sorbi1|5035227|Sb03g005540 XP_002455174.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]