SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5035278|Sb03g006110 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5035278|Sb03g006110
Domain Number 1 Region: 518-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-67
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 69-172,202-237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.52e-16
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5035278|Sb03g006110
Domain Number - Region: 416-454
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00322
Family Pan module (APPLE domain) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5035278|Sb03g006110
Sequence length 819
Sequence
MISAVHLLHLSLFLLAMLLLQPYVLVAMSTTTRSSLAAGDSLTPPNYITSPSGDFAFGFR
ALLDSNSSFLLAIWFRFDAGRKVVWFAADAAGSGSAVVVAAGQSVLNLTAAGQLSLLAAA
ASPSNAALLWSPYTDPSQNYGSLLALRDTGNLQFLAADGTTVVWESFGHPTDTLLPGQVM
PPGTLLRSRASDDDDTDYSSTGRFILIVQNDGNIVWYRTDLPGGSSTSSNAYWSTQTCCV
ANGNTTLFFDAELVGHLYYQLTDGTSRNLTAPQRVPASAAGTGSSFFYQHATLDPDGILR
VYILPNNTGGHGGGGNATTWSVVNPPVPSDGCQAVTNGRRGMCGPNSYCVYDADNRLDCE
CLAGYTFLHTQSRYQGCAPAFLQDTCNNNDHRRTKSHASEFQLVELPNTYWVDTIFYEQH
QSVTAAQCQDLCLHNCHCAAALFNGSSNSCLEAPMLTAGWQQNGTSISTLVKVRIRGPPA
VILPYAVIAGLGMLFLVTACILLVHCYITNRNARNRKHLSATVFTRKELRRATNGFSKLL
GQGGFGKVYHGIVKSLEPHDVAVKELRSGDEYQETEFENEVQSIGRIHHKNLVRMVGYCK
EGVHRMLVFEFMPGGSLGDVLFKPSGERRPSWSWRAEAAVAIARGLEYLHYGCTAQIVHC
DIKPDNILLDDRRIPKITDFGIARLLDGDKLKQTITHVRGTLGYLAPEWFSSERKVDSKV
DVFSFGVVLLEMICCRKHPPPPPPPAPAPADDGGQDGPRCSDDDDDSEEDIGMPVTLRAW
VSDLVREGEVWRAVQGDKEALQDLERVERFARIASWCSP
Download sequence
Identical sequences jgi|Sorbi1|5035278|Sb03g006110 4558.Sb03g006110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]