SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036395|Sb03g030710 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036395|Sb03g030710
Domain Number 1 Region: 488-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-75
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 67-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.15e-29
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Domain Number 3 Region: 336-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000432
Family Anti-platelet protein 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036395|Sb03g030710
Sequence length 794
Sequence
MAADKHRLLYPIFLSLLSVPLCSRASPWQAVGTGSSLQVDHGEIFLVSPDTTFSCGFYSS
GQGTNAYYFSIWFTHSTDRTVVWTANRGSPVNGHGSKIYFNRQGNLLLTDVNGSTVWQSK
TKWGKHASVALLNSGNLVVRASTDQVVWQSFDSPTDTLLPSQRLTREMRLVSQSGYHRLY
FDNDNVLRLLYNGPDITSIYWPSPDYNALQNGRTRFNSSKIAVLDNDGIFWSSDGFRMIA
SDSGFGIKRRITIDYDGNLRMYSLNAAGNWIITGEALLQLCYVHGLCGKGGICEYSQSLK
CTCPPGYNMTDPKDWNKGCSPTFNTNCGQPREDFTFIKIPHGDFYGFDLTSNQSISFEEC
KRICLDSCLCLSFTYKAGQGLCYTKNQLYNGQVYPYFPGDSYIKLPKKITPTYSASNHST
LTCSPKNTKVMLVSKDEYMKNSDNINWTYFYAFATILGAVELLFIMTGWYFLFKMHNIPK
SMEEGYKMITSQFRRFTYRELVEATGKFKEELGKGGSGTVYRGILADKKIVAIKKLTDVR
QGEEEFWAEVTLIGRINHINLVRMWGFCSEGKHRLLVYEYVENESLDKYLFGDRRTETLL
SWSQRFKIALGTARGLAYLHHECLEWVVHCDVKPENILLTRDFEAKIADFGLSKLSKRDS
PSFNFTHMRGTMGYMAPEWALNLPINAKVDVYSYGVVLLEIVAGSRVSSGITIDEEEMDF
MQFVQEVKQMLARGGNLDIVDARLKGHFSHEQATVMVKIAVSCLEERSKRPTMDQIVKDL
MVYNDEDDHPAYSL
Download sequence
Identical sequences C5XG13
jgi|Sorbi1|5036395|Sb03g030710 4558.Sb03g030710.1 XP_002458288.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]