SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036396|Sb03g030720 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036396|Sb03g030720
Domain Number 1 Region: 495-768
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.7e-60
Family Protein kinases, catalytic subunit 0.00046
Further Details:      
 
Domain Number 2 Region: 63-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-25
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036396|Sb03g030720
Domain Number - Region: 348-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00126
Family Pan module (APPLE domain) 0.065
Further Details:      
 
Domain Number - Region: 260-339
Classification Level Classification E-value
Superfamily beta-Barrel protease inhibitors 0.0199
Family Metalloprotease inhibitor 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036396|Sb03g030720
Sequence length 778
Sequence
MAALLYLALLLLLTFPVCSGASPWQTMTTGSHIRGEDHDKVILLSPDATFSCGFHEVGTN
ALTFSIWYTTHAAERTVVWTANPYSAERGGYSPVNKYGSRVSLNRDGNLILTDTNGSMVW
ESKTSSGKHTTVTLLNSGNLVISDSSNKIMWQSFDSPTDTLLPGQNLTKDTRLVSGYHHL
YFDNDNVLRMLYDGPEITSIYWPSPDYDAQKNGRNRFNSTRIAVLDDMGNFTSSDGFKIE
ASDSGPGIKRRITIDYDGNFRMYSLNASTGKWDITGQAVIQMCYVHGLCGKNGLCDYLGG
LRCRCPPDYEMVDPTNWNKGCKPMFLTDGNQAREEFTFIEQPHADYYGFDLSSNKSIPFE
ACRNICWNSSTCLSFTYKGGDGWCYTKDLLYNGQVFPYFPGDNYMKVPMSFNTSTYSISK
QKTLTCGPAGSENMLGPASMYGTKKDNINWTYFYVFAAILGALELLVIVTGWYLFFKKHN
IPKSMEDGYKLVTNQFRRFTYRELREATGKFKEELGRGGAGIVYRGVLEDKKIVAVKKLT
DVRQGEEEFWAEVTLIGRINHINLVRMWGFCSEGTKRLLVYEYVENESLDKYLFGERSTE
SLLGWSQRYKIALGTARENILLTRDFEAKIADFGLAKLAKQGSTSFNFTHMRGTMGYMAP
EWALNMPINAKVDVYSYGVVLLEIVTGIRASSGIMLDERQIDFLEFVQEAKQILSTGNVS
DIVDDRLHGHFHTEQAIAMVKIAFSCLEERRKRPTMDEIVKVLMSCDDEDDYHPAYSY
Download sequence
Identical sequences 4558.Sb03g030720.1 jgi|Sorbi1|5036396|Sb03g030720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]