SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036399|Sb03g030730 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036399|Sb03g030730
Domain Number 1 Region: 505-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-72
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 66-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.42e-23
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036399|Sb03g030730
Domain Number - Region: 344-387
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0184
Family Anti-platelet protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036399|Sb03g030730
Sequence length 810
Sequence
MLRKLPRLAILISLLSLLLRSSASASAQHTLGPGSSLSVEDHARPFLVSPDATFSCGFLD
AGDNAFSFSVWYTAAANKTAVWTANPDAAVNGRGSRISFRHDGGLALSGANGTTVWETKT
SGAGLSVSLLNSGNLVVSDPSSGGGRTLWQSFDWPTDTLVPSQRLTKNTTLVSRFFFLYF
DNDNVLRLRYDGSDISSIYWPNPDYGVFPNGRTAYNSSRIAVLDDTGVFLSSDNLRVVAA
DLGVPGVKRRLTIDPDGNLRIYSLDPSTGAWTATWAAMAQACSAHGLCGRNAMCVYQPSL
RCSCVPGHEMVDRHDWRQGCRPMFGVTNCSQQAAVPEQEQRLKFVVVPHTDFYGYDVGYN
KTVTFEHCKKLCLEMCSCAAFSYRPFEGGGLCYPKGFLYNGYTSPNFQGNIYLKVPIDFD
ASAQSVSARSSEGLACNPDGPEIVQGNPDTFQTSRNNARWSYLFAFAGVLGVLDIIFIAT
SWWFLSSKQSIPSSLEAGYRMVTGQFRRFTYGELKDATGNFKEELGRGGSGVVYRGVLDK
GKKVVAVKKLTNVAGGDEEFWAEMTLIGRINHINLVRIWGFCSQGKHRLLVYEYVENQSL
DRHLFDTDRTTPLPWRERYRIALGTARGLAYLHHECLEWVIHCDVKPENILLTREFDAKI
ADFGLAKLSKRNDGAGGDGMQLSHMRGTTGYMAPEWALNVPINAKVDVYSYGVVLLEMVM
GCRVCDQTTAGGERLEMAQIAQALRQVVASGNVVPLVDGRLQGQFNPRQALEMVRISLSC
VEDRSNRPTMDDVAKALTACDDEDEHPAYK
Download sequence
Identical sequences 4558.Sb03g030730.1 jgi|Sorbi1|5036399|Sb03g030730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]