SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036504|Sb03g032240 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036504|Sb03g032240
Domain Number 1 Region: 5-245,362-489
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-67
Family Subtilases 0.008
Further Details:      
 
Domain Number 2 Region: 269-338
Classification Level Classification E-value
Superfamily PA domain 0.000068
Family PA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036504|Sb03g032240
Sequence length 675
Sequence
MYDEGVWPESQSFQNDTMLDVPLGRWHGTCEKGNDPTFQCNRKLIGARFFSEGIQASGAL
SGDGGQQPPTSQADLSSPRDYVGHGSHTLSTAGGSFVRGASVYGHGKGTAAGGAPGARVA
MYKACYEPGCSGIDILAAILKAVADGVHVLSLSLGAPPADYLTDLTAIGAFFAVQSGVTV
VCSAGNSGPQPSTVTNLAPWIFTVAASTMDRDFPAYVSFNGSDSIQGQSLAESTLPIGQP
YQIISGEKANAVNQPTGNSSLCLPGSLDPDKVKGKIVVCVRGVNARVEKGFVVKQAGGVG
MVLCNDAGTGDTVVADAHVLPAAHCSFSQCARLFTYLQSTNNPLGYINATDASFGVKPAP
KIAAFSSRGPNAITPQILKPDITAPGVNVIAAYSGAVSPTELPFDDRRVAYNIMSGTSMS
CPHVSGIVGLLKTKYPTWSPAMIKSAIMTTASTTANDGNPIQDEAGAAATPFGYGSGHVD
PVRALDPGLVYDTTLLDYTNFLCSSLKPTQATQGDPIPSLLPVDLPPVLGNLSQPVINLL
LLPLFNAAGEPCKCSQGPYGRPEDLNYPSIAVPCLSGSGSGSGATATVKRRLKNVAGAPG
KYKVTVTEPAGVKVTVAPSELEFRVGEEKEFTVTVKLDMDANAPAAASTYVFGSIVWSDT
AHRVRSPVVVKTKCG
Download sequence
Identical sequences 4558.Sb03g032240.1 jgi|Sorbi1|5036504|Sb03g032240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]