SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036542|Sb03g032870 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036542|Sb03g032870
Domain Number 1 Region: 243-326
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 153-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036542|Sb03g032870
Sequence length 343
Sequence
MADADAPPPTPPPEVVAPEKHPAPVDSAVSALQKEAATAEVDNKRKLEEVSADAEANGTG
EEGAKHPRVDGEPDAATGVEQQNDGSSVNVEEPAAAEDKLALAPTDGAAMDGDDDGTAAP
APDSQAGSDEKPLEAAAEAPQQERVAVAEAAAQEISRTIEVPNSKVGVLIGKAGETIRNL
QKSSGAWIQIAKHADVDSNALTRSVLLVGKPGSVDKAEQLIESVIAEAEAARGFGSGQSG
SEQFDMAVPNNKIGLIIGKRGETIKDLQLKSGARIEFIPKIPLEGVTSTGRIVRVTGNKQ
QIEVAKDLIKQAVNQTFPKHTNQSGRYGPQGYRPQGRGAGSQW
Download sequence
Identical sequences A0A1W0VZ53
jgi|Sorbi1|5036542|Sb03g032870 4558.Sb03g032870.1 XP_002458405.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]