SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036575|Sb03g033440 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036575|Sb03g033440
Domain Number 1 Region: 115-404,518-645
Classification Level Classification E-value
Superfamily Subtilisin-like 1.11e-69
Family Subtilases 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036575|Sb03g033440
Domain Number - Region: 386-496
Classification Level Classification E-value
Superfamily PA domain 0.000484
Family PA domain 0.016
Further Details:      
 
Domain Number - Region: 34-101
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0621
Family Subtilase propeptides/inhibitors 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036575|Sb03g033440
Sequence length 785
Sequence
MRGASALALPSLLLVLTLSSSLCNVSASTKQDQVYIVYLGEHAGAKAEEAILDDHHTLLL
SVKSSEEEARASLLYSYKHTLNGFAALLSQEEATKLSEKSEVVSAFRSEGRWAPHTTRSW
QFLGFEEGVTNPPDGREWLPSLDKSSEDIIVGILDSGIWPESRSFSDQGLGPVPARWKGT
CQGGDSFSSSSCNRKIIGARYYVKAYEAHYKGLNTTNAFRSPRDHDGHGTHTASTVAGRT
VPGVSALGGFANGTASGGAPLARLAVYKVCWPIPGPNPNIENTCFEADMLAAMDDAVGDG
VDVMSVSIGSSGAPLRFADDGIALGALHAAKRGVVVSCSGGNSGPKPATVSNLAPWMLTV
AASSIDRAFHSPIKLGNGVMVMGQTVTPYQLPGNKPYPLVYAADAVVPGTAANVSNQCLP
NSLSSDKVRGKIVVCLRGAGLRVEKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTA
VAAADANTILSYIKSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITA
PGLNILAAWSQASSPTKLDGDHRVVQYNIMSGTSMSCPHVSAAAVLVKAAHPDWSSAAIR
SAIMTTATTNNAEGGPLMNGDGSVAGPMDYGSGHIRPKHALDPGLVYDASYQDYLLFACA
SAGSGSQLDPSFPCPARPPPPYQLNHPSVAVHGLNGSVTVHRTVTNVGSGEARYTVAVVE
PAGVSVKVSPKRLSFARTGEKKAFRITMEAKAGSSVVRGQFVAGSYAWSDGGAHVVRSPI
VVLVA
Download sequence
Identical sequences jgi|Sorbi1|5036575|Sb03g033440 4558.Sb03g033440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]