SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5036763|Sb03g036620 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5036763|Sb03g036620
Domain Number 1 Region: 427-705
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-73
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 87-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-19
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5036763|Sb03g036620
Domain Number - Region: 290-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0746
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5036763|Sb03g036620
Sequence length 727
Sequence
MALPTTQSLPTPKTVIAGNISLVWENSERCLSDLTARTDIIFQNQSISDGQTLVSMGKEF
VLGFFSPGASSNRYVGIWHNDVSERRAVWVANRNNPFQDTFGILKFDNNSNLIVLDGRGN
SFTVAYGRGVQDVEAAILDNGNFVLRSIRNQAKIIWQSFDFPTDTWLPEMNIILGSKLTS
WKSYDDPAVGDYSFGLDVTNALQLIILWKGNNYWTFGPWNATLKSLIPELKYIPVTPVSF
QCGNLTCTYTSNPSDTMAKIVLDPNGSLNIAQFSPGTESWTLLWRQPASCEVSNLCGGFG
ICNNNMLTNDPMSSLCRCPKGFAQQDIITGNTWKGCTRQIQLQCNGDSLWYGNLTNMQDG
YNGSGVGTLYLRVAASELESSNSSGMKFVPFDSPNKWMAYLVKTSELLHLETCILDRFFP
LNMVVEYKGHLPDGREIAVKRLAANSGQGLPEFKNEVLLIARLQHTNLVRLLGCCIEEEE
MLLVYEYMPNKSLDFFLFEKSRRALLDWEMRMNIIEGVAQGLIYLHKHSRLRIIHRDLKA
SNILLDTDMNPKISDFGMARIFDPKGTQANTKRVVGTYGYMAPEYAMAGNFSTKSDVFSY
GVLLLEIISGMKNAGSRRHGNSVSLLGYAWELWNEGRCHELIDKPLHGRCPENVALRCIH
VSLLCVQEQAADRPSMTEVISMITNGSAILPDPKQPGFLSMLVPNETDIAEETCSLNGLS
VTILDGR
Download sequence
Identical sequences jgi|Sorbi1|5036763|Sb03g036620 4558.Sb03g036620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]